PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08471A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 321aa    MW: 33977.8 Da    PI: 7.7574
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08471AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.21e-41121111100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeA+ar+rdPvyG+v+ i+ lq
  Oropetium_20150105_08471A  12 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFANVHRVFGASNVSKLLHDLPHAQREDAVNSLAYEADARLRDPVYGCVSYISVLQ 95 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                 +++q++ ela++++e
  Oropetium_20150105_08471A  96 LRIRQTRDELAAARKE 111
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1911112IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4112109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSSSSSSSSS SPCAACKLLR RKCTQGCVFA PYFPPDNPAK FANVHRVFGA SNVSKLLHDL  60
PHAQREDAVN SLAYEADARL RDPVYGCVSY ISVLQLRIRQ TRDELAAARK ELAAYVGPAA  120
AYAPFVAATP PPPQYHHHHH THYAQAAAAA AAQYAASVPA AAGIGLGAHG GHTHQQITAQ  180
QQLLQQQNQH IPLHHQLGEA QRLAAAVEIA NREQQDLMHL RQQQATAAYA HAGSGATVAA  240
VVPPDASRNE GGFFFQQQQE QQPSSRPQTA VALTYQIMEP SPPPPPPSSS GQSPTAKVSS  300
RQEHMEGSDE GSGGGVVPPP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-91PREDICTED: LOB domain-containing protein 6
TrEMBLK4ADE81e-91K4ADE8_SETIT; Uncharacterized protein
STRINGSi036905m4e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-48ASYMMETRIC LEAVES 2-like 1